TKPRPGP comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2026-08-01. Numbers and descriptions here follow the published literature rather than marketing material.
Selank is studied chiefly as an animal-model anxiolytic with proposed secondary effects on memory and immune signaling. Reported mechanisms include modulation of the GABA-A receptor complex, inhibition of enkephalin-degrading enzymes, and shifts in monoamine turnover within limbic structures. Some experiments describe increased expression of brain-derived neurotrophic factor in the hippocampus after repeated dosing. No single molecular target has been confirmed, and the peptide does not bind any receptor with the selectivity typical of a conventional small-molecule drug. Mechanism therefore remains a set of hypotheses rather than an established pathway.
Laboratory work relies on standard behavioral paradigms. Rodents are tested in the elevated plus maze, open field, and passive avoidance tasks, with outcomes compared against diazepam or vehicle controls. Intranasal dosing is used most often because it bypasses first-pass metabolism, though intraperitoneal and intravenous routes also appear in published protocols. Biochemical endpoints include tissue BDNF concentrations, cytokine levels, and monoamine metabolites. Human data are limited to small Russian trials reporting reduced anxiety scores; most were not prospectively registered, and few employed independent outcome assessment.
Lyophilized material is generally stable for extended periods when kept dry at or below minus twenty degrees Celsius. Working solutions are less stable, and common practice is to aliquot and freeze them so that repeated freeze-thaw cycles are avoided. Aqueous solutions are sensitive to pH extremes and to microbial growth, so short-term storage at refrigerator temperature is typical. Oxidation and hydrolysis are the principal degradation routes. Reconstitution with sterile water or a mild buffer is standard, and solutions should be protected from light.
Regulatory treatment varies by jurisdiction. In Russia the compound is a registered prescription product, while in the European Union and the United States it is generally handled as a research chemical without a marketing authorization. Suppliers therefore operate outside pharmaceutical oversight, and buyers rely on supplier documentation for purity and identity claims. Chain of custody and third-party testing are the main verification tools. Analysts note that the absence of a pharmacopoeial monograph for research-grade material limits standardization across vendors.
Purity assessment relies mainly on reverse-phase high-performance liquid chromatography with ultraviolet detection. Because the peptide lacks a strong chromophore, detection often uses backbone absorbance near 214 nm. Identity is confirmed by mass spectrometry, typically electrospray ionization or matrix-assisted laser desorption, comparing the measured mass against the expected value. Amino acid analysis can verify composition after acid hydrolysis. Diastereomer content and residual counterions are reported less often, although both can influence biological assays.
| Property | Value | Notes |
|---|---|---|
| Principal proposed target | GABA-A receptor complex | Hypothesis derived mainly from animal pharmacology |
| Common behavioral assay | Elevated plus maze | Rodent test for anxiety-like behavior |
| Reported molecular marker | Hippocampal BDNF expression | Measured by immunoassay or mRNA quantification |
| Typical dosing route | Intranasal | Chosen to reduce first-pass metabolism |
| Reported plasma half-life | Minutes | Based on limited peptide stability data |
Selank is not a naturally occurring peptide and has no known endogenous counterpart in human physiology. Russian-language sources frequently call it TP-7, while English-language sources use the name Selank almost exclusively. Database indexing is uneven, partly because early reports appeared in regional journals that are not widely cataloged. Some summaries describe the material as a tuftsin analog and others as a synthetic heptapeptide; the labels overlap rather than conflict. Citing the primary sequence resolves ambiguity more reliably than the research or trade name alone.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, written TKPRPGP in one-letter notation. Its structure consists of the immunomodulatory tetrapeptide tuftsin, Thr-Lys-Pro-Arg, extended at the carboxyl terminus by a Pro-Gly-Pro segment. The molecular formula is commonly given as C33H57N11O9, corresponding to a monoisotopic mass near 751.4 Da and an average molecular mass near 751.9 Da. All seven residues are proteinogenic amino acids, and the molecule carries no modified side chains or non-natural linkages.
The compound was designed at the Institute of Molecular Genetics of the Russian Academy of Sciences during the 1980s and 1990s. The stated design goal was to retain the immunomodulatory and central nervous system activity attributed to tuftsin while improving resistance to enzymatic breakdown. Adding a proline-rich tail to the short parent peptide was a deliberate strategy, because proline residues restrict the conformations available to many peptidases. The same laboratory produced Semax, an ACTH fragment analog, and both compounds were developed in parallel as short, enzymatically stabilized peptides intended for intranasal use.
Clinical evidence comes mainly from small studies conducted in Russia, several of which were open-label or lacked robust blinding. Reported outcomes include lower anxiety scores, changes in attention measures, and effects on asthenic states following illness. Sample sizes are typically in the tens of participants, and independent replication outside the region is scarce. Reviews published in English generally note the limited methodological quality of the underlying trials. Whether the compound produces clinically meaningful effects under rigorous conditions remains unresolved.
Proposed mechanisms center on modulation of the GABA system, but no single molecular target has been confirmed. Rodent studies report changes in GABA-A receptor expression and in the turnover of serotonin, dopamine, and norepinephrine in several brain regions. Increases in brain-derived neurotrophic factor and its receptor have also been described after repeated administration. These findings come largely from animal models, and the degree to which they describe human neurochemistry remains an open question. The mechanism is best characterized as multi-system and not fully resolved.
Peptide bonds in selank are susceptible to hydrolysis under strongly acidic or basic conditions, and the terminal proline residues are vulnerable to exopeptidase activity in biological samples. Lyophilized powder stored dry at -20 °C typically remains stable for extended periods, whereas aqueous solutions degrade faster and may lose measurable purity within days to weeks depending on pH, temperature, and microbial load. Repeated freeze-thaw cycles promote aggregation and adsorption to container surfaces. For analytical work, solutions are usually prepared fresh, kept cold, and used within a single working day.
Handling follows standard practice for research peptides. Material is weighed in a low-humidity environment because the powder absorbs atmospheric moisture. Purity is reported as the percentage area of the main peak in a chromatogram, with specifications commonly set at 95 percent or higher; values below that threshold indicate the presence of truncated or modified species. Residual trifluoroacetate from purification is often present and may affect mass balance. Certificates of analysis should state the analytical method, the column and gradient used, and the lot-specific retention time so that results can be compared across suppliers.
Identity and purity of selank are established with reversed-phase high-performance liquid chromatography coupled to mass spectrometry. The peptide elutes from C18 columns with acetonitrile gradients in water containing trifluoroacetic acid or formic acid, and detection is usually performed by ultraviolet absorbance near 214 nm. Electrospray ionization in positive mode gives a doubly protonated ion near m/z 377, consistent with a mass of about 752 Da. Amino acid analysis or tandem mass spectrometry of fragment ions confirms the sequence. Because the molecule has no aromatic residues, it lacks a usable 280 nm chromophore, so low-wavelength detection or mass spectrometry is required.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, frequently abbreviated as TKPRPGP. It was designed as a structural analogue of tuftsin, a naturally occurring tetrapeptide released by enzymatic cleavage of the immunoglobulin heavy chain. The two additional proline residues at the C-terminal end extend the parent chain and change how the molecule behaves in solution. The free peptide has a calculated molecular mass of approximately 751.9 g/mol and is generally supplied as a lyophilised white to off-white powder.
Development work on the compound began in the 1980s and 1990s at the Institute of Molecular Genetics in Moscow, within the same research programme that produced the peptide Semax. Early investigators sought a tuftsin derivative with improved resistance to enzymatic breakdown and with activity in the central nervous system after peripheral administration. Most of the primary literature from this period was published in Russian, a factor that still shapes how easily the findings can be checked by outside groups.
Because of the great insolubility of thorium dioxide, thorium does not usually spread quickly through the environment when released. The Th4+ ion is soluble, especially in acidic soils, and in such conditions the thorium concentration can be higher.
Artificial intelligence provides a number of tools that are useful to bad actors, such as authoritarian governments, terrorists, criminals or rogue states. There are many ways in which AI is expected to help bad actors, some of which cannot be foreseen. For example, machine-learning AI is able to design tens of thousands of toxic molecules in a matter of hours.
Kipa-Williams explained that Marilyn "stumbles" across the family living out of their car on her way to work, and invites them to stay with her, but they initially turn her offer down. Gemma's pride stops her from accepting Marilyn's offer, until she realises that the family needs to come first. When John returns home, he is surprised to find the family in his house. Kipa-Williams believed John was jealous of Ari's connection with Marilyn, saying "John doesn't like the fact that Marilyn has this bond with Ari. He wishes she shared that connection with him, and John starts to grow jealous – it gets heated a few times." Symons explained that for Marilyn, letting the family stay with her is her way of paying back Ari for comforting her during the siege. She sees that the family is struggling and wants to help them settle in the Bay. John's opposition causes problems in his marriage, as he does not understand why Marilyn would invite the family to stay. Symons was excited about the Parata's introduction, as it gave everyone "a new energy to play off." The fractious nature of Ari and Tane's relationship comes to a head when they fight over their nephew. After Nikau gets fed up living with Ari and Gemma, he seeks out his uncle and stays the night at his place. When Tane drops him off in the morning, Ari accuses Tane of being "a bad influence" and the pair have a physical altercation by the road. Following a break-in at the Pier Diner, Constable Colby Thorne (Tim Franklin) is convinced the Paratas had something to do with it and he becomes "desperate" to pin the crime on them.
==== Renaissance and Reformation (c. 1400–1550) ==== Johannes Gutenberg's moveable‐type printing press (c. 1450s) ushered in the information age and rise of newspapers. Conquest of Constantinople by the Ottoman Empire (1453) marked the fall of the Byzantine Empire. Christopher Columbus's first voyage to the Americas (1492) initiated sustained contact between Europe and the New World. Amerigo Vespucci's Mundus Novus letter (1503), the first explicit articulation in print of the hypothesis that the lands discovered by European navigators to the west were not the edges of Asia but rather an entirely different continent, is published. Niccolò Machiavelli's The Prince (c. 1513), a foundational work of modern political philosophy. Martin Luther's posting of the 95 Theses (1517) ignited the Reformation. The broader Age of Discovery saw unprecedented maritime exploration and early colonial empires. Nicolaus Copernicus's De revolutionibus orbium coelestium (1543) proposes that the Earth revolves around the Sun. Council of Trent (1545) begins the Catholic Counter-Reformation. Rise of Mercantilism as the prevailing economic theory.
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The positive transcription elongation factor, P-TEFb, is a multiprotein complex that plays an essential role in the regulation of transcription by RNA polymerase II (Pol II) in eukaryotes. Immediately following initiation Pol II becomes trapped in promoter proximal paused positions on the majority of human genes (Figure 1). P-TEFb is a cyclin dependent kinase that can phosphorylate the DRB sensitivity inducing factor (DSIF) and negative elongation factor (NELF), as well as the carboxyl terminal domain of the large subunit of Pol II and this causes the transition into productive elongation leading to the synthesis of mRNAs. P-TEFb is regulated in part by a reversible association with the 7SK snRNP. Treatment of cells with the P-TEFb inhibitors DRB or flavopidirol leads to loss of mRNA production and ultimately cell death. P-TEFb was identified and purified as a factor needed for the generation of long run-off transcripts using an in vitro transcription system derived from Drosophila cells.
== Predicted properties == Other than nuclear properties, no properties of roentgenium or its compounds have been measured; this is due to its extremely limited and expensive production and the fact that roentgenium (and its parents) decays very quickly. Properties of roentgenium metal remain unknown and only predictions are available.
24 September – Scientists report the successful return of samples from NASA's OSIRIS-REx mission to the asteroid 101955 Bennu. Shortly after the sample container was retrieved and transferred to an "airtight chamber at the Johnson Space Center in Houston, Texas", the lid on the container was opened. Scientists commented that they "found black dust and debris on the avionics deck of the OSIRIS-REx science canister" on the initial opening. Later study was planned. A news conference on the asteroid sample is scheduled for 11 October 2023. 25 September A study on Pangaea Ultima finds that the hypothetical supercontinent will make Earth uninhabitable to most life forms in 250 million years, due to extreme temperatures and radiation. Biologists report the discovery of a ninth species of pangolin, a mammal which is covered with large, protective keratin scales. 26 September – Work begins on the seventh and final primary mirror of the Giant Magellan Telescope, which is expected to provide quadruple the image resolution of previous observatories when completed.
Compared to HLF, LSF employs pure cultures at a relatively higher temperature (40–55 °C (104–131 °F)) and lower brine solution concentrations (13–15%). In LSF, koji is mixed with the equivalent weight of brine to form solid moromi. The elevated temperature accelerates the fermentation process significantly. Due to the short aging (15–30 days) period of LSF, and low production cost, LSF soy sauce accounts for more share of the Chinese soy sauce market. LSF evolved from salt-free solid-state fermentation, an even faster method working at even higher temperatures (50–65 °C (122–149 °F)) and taking 72 hours to complete, introduced to China from the Soviet Union in 1958. The aging time turned out to be too short develop a proper flavor profile, with burnt acidic notes left in the sauce. LSF is a compromise between this method and the more traditional HLF: the product tastes passable with more microbes allowed to survive, but still lacks depth. Reducing the salt content accelerates brewing by lifting salt-induced enzyme inhibition.
Sources: en.wikipedia.org
Intranasal administration predominates in both animal and human research because it avoids hepatic first-pass metabolism. Injectable and intraperitoneal routes appear in animal work mainly for comparison.
Behavioral endpoints include time spent in open arms of the elevated plus maze and avoidance latencies. Biochemical endpoints include BDNF concentration, cytokine levels, and monoamine metabolite ratios in brain tissue.
Most published studies are small, originate from a limited number of laboratories, and lack independent replication. Dose-response relationships, measured brain exposure, and long-term outcomes are not well characterized.
Purity is usually reported as an HPLC area percentage, most often measured at 214 nm. Identity is confirmed separately by mass spectrometry. A certificate of analysis should state both the method and the observed value.