The short version of reconstitution fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2026-06-22 and is reviewed periodically as new material appears.
Reconstitution involves adding a solvent to dry peptide, often water or a buffered solution. The chosen liquid should match the peptide's solubility and intended assay, and it should be free of contaminants. Gentle mixing or inversion reduces foaming and shear, which can damage some peptides. If the peptide does not dissolve readily, adjusting pH or using a small amount of organic co-solvent may help. The final solution is typically clarified before use in analytical or laboratory procedures.
After reconstitution, solutions are usually divided into single-use aliquots to limit repeated handling. Each aliquot is stored at a temperature appropriate for the peptide, with -20 °C or -80 °C common for longer-term laboratory storage. Freeze-thaw cycles are minimized because they can cause aggregation, precipitation, or loss of activity. Temperature monitoring and documented storage conditions support reproducibility across experiments. When a peptide is removed from storage, it is typically allowed to equilibrate before opening to reduce condensation.
Peptides are short chains of amino acids linked by amide bonds. Their stability depends on sequence, length, and the chemical environment. Common degradation routes include hydrolysis of the peptide backbone, oxidation of methionine or cysteine residues, deamidation of asparagine or glutamine, and aggregation through hydrophobic or electrostatic interactions. These processes can alter mass, charge, or biological activity, so storage conditions aim to slow them. The relative importance of each route varies widely among peptides.
Water is a central factor in peptide degradation because it enables hydrolysis and mobilizes reactive species. Lyophilized or dry powders typically remain stable for longer than solutions when kept cool and dry. Oxygen can drive oxidation, particularly for sulfur-containing residues, while light can catalyze side-chain damage. Buffer choice and pH influence charge state and can accelerate or slow deamidation and aggregation. Freeze-thaw cycles may concentrate solutes or promote ice-induced aggregation, so minimizing such cycles is a common handling goal.
Lyophilization removes water under vacuum from a frozen solution, leaving a porous cake or powder. Formulation excipients such as sugars or polyols can stabilize structure during freezing and drying and can raise the glass transition temperature. Residual moisture in the final product remains a critical variable because even small amounts can support hydrolysis over time. Storage recommendations often specify desiccation, darkness, and low temperature, though exact conditions depend on the peptide and its intended use. Stability studies measure changes under defined conditions rather than predicting absolute shelf life.
| Property | Value | Notes |
|---|---|---|
| Container material | Glass or inert plastic | Compatibility depends on peptide and solvent |
| Headspace gas | Nitrogen or argon | Used to limit oxygen exposure |
| Common reconstitution solvent | Water or buffered aqueous solution | Organic co-solvents may be needed for hydrophobic peptides |
| Freeze-thaw stability | Varies by peptide | Aliquoting reduces repeated cycles |
| Documentation | Lot, date, concentration, storage location | Supports traceability and reproducibility |
Reconstitution introduces new risks because the peptide contacts solvent, air, and container surfaces. The chosen solvent should match the peptide's solubility profile, and buffer salts, pH, and ionic strength can affect dissolution and subsequent stability. Gentle mixing is preferred over vigorous vortexing, which can create interfaces and shear. If the solution is not clear, the cause may be incomplete dissolution, aggregation, or insoluble counter-ions rather than a simple concentration problem. Filtration is sometimes used, but filters can adsorb peptides and alter measured concentration.
Cold-chain practice relies on documented temperature ranges, calibrated monitoring, and minimized excursions. Shipments may use insulated boxes, phase-change materials, or dry ice, with data loggers to record conditions. Upon receipt, the recipient should verify the logger trace and place items into long-term storage promptly. Repeated warming and cooling during transfers can be more harmful than a single controlled excursion. For solutions, dividing material into single-use aliquots reduces the number of thawing and refreezing events and limits repeated opening of the same container.
Handling begins before a peptide arrives at the bench. Containers should be inspected for cracks, loose caps, or visible moisture, and labels should record identity, lot, and receipt date. Lyophilized material is often allowed to equilibrate to room temperature before opening to prevent condensation on the powder. Gloves and a clean workspace reduce contamination and static-related loss. Once opened, the vial may be purged with inert gas and resealed if the peptide is sensitive to oxygen or humidity. These steps are procedural safeguards rather than guarantees of stability.
Temperature is the most common controlled variable, but its effect is not linear. Lower temperatures reduce most chemical reaction rates, yet freezing can concentrate solutes and create pH shifts in the remaining liquid phase. Repeated freeze-thaw cycles can denature or aggregate some peptides, especially those with hydrophobic segments. For lyophilized powders, desiccation and protection from moisture are often more important than deep freezing. For solutions, the choice between refrigeration and freezing depends on peptide concentration, buffer components, and the intended duration of storage.
Peptides are short chains of amino acids whose physical and chemical stability depends on sequence, length, conformation, and the surrounding matrix. In the solid state, lyophilized powders are generally more stable than solutions because low water activity slows hydrolysis and oxidation. Residual moisture, oxygen, trace metals, and light can still promote degradation over time. Storage recommendations therefore balance temperature, humidity, and container integrity rather than relying on a single condition. The optimal condition for a given peptide is often determined empirically because no universal rule covers every sequence.
In aqueous solution, peptides are vulnerable to hydrolysis, oxidation, deamidation, and aggregation, with rates influenced by pH, temperature, buffer composition, and ionic strength. Acidic or neutral pH ranges often slow deamidation, while extreme pH can accelerate peptide bond cleavage. Dissolved oxygen and redox-active metal ions contribute to oxidation of methionine, cysteine, and tryptophan residues. Aggregation may be driven by hydrophobic interactions or by interfaces such as air-liquid and container surfaces. Because these pathways interact, solution storage usually requires tighter control than storage of dried material.
I was expecting to retrieve the body from a fridge in the mortuary, but... it was stored in a body bag that was kept on the floor of a garage away from the main hospital building. She was in a transparent body bag packed with wood shavings and sawdust. There was also some kind of liquid and I remember that I was frightened that the bag would split open. The body was covered in sores and scars – it was quite horrific. I was on my own and I needed help to lift the body... but I managed to get her into the van. People from the hospital were very wary of helping me... When the day of the funeral arrived, the cars were given an escort by unmarked police vehicles just in case there was an accident... The body had to be cremated because there was a chance the virus could have thrived in the ground if Mrs Parker had been buried. All other funerals were cancelled that day and the Robin Hood Crematorium was thoroughly cleaned afterwards. Concerns over the survival of infectious virus in Parker's body were well-founded, and at the inquest the coroner, who signed Parker's cremation certificate, disallowed an autopsy for safety reasons.
An alpha helix (or α-helix) is a sequence of amino acids in a protein that are twisted into a coil (a helix). The alpha helix is the most common structural arrangement in the secondary structure of proteins. It is also the most extreme type of local structure, and it is the local structure that is most easily predicted from a sequence of amino acids. The alpha helix has a right-handed helix conformation in which every backbone N−H group hydrogen bonds to the backbone C=O group of the amino acid that is four residues earlier in the protein sequence. The alpha helix is also commonly called a: Pauling–Corey–Branson α-helix (from the names of three scientists who described its structure) 3.613-helix because there are 3.6 amino acids in one ring, with 13 atoms being involved in the ring formed by the hydrogen bond (starting with amidic hydrogen and ending with carbonyl oxygen)
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Mouse MA-10 cells respond to 5-oxo-ETE but lack OXER1. It has been suggested that these cells' responses to 5-oxo-ETE are mediated by an ortholog to OXER1, mouse niacin receptor 1, Niacr1, which is a G protein-coupled receptor for niacin, or, alternatively, by one or more of the mouse hydroxycarboxylic acid (HCA) family of the G protein-coupled receptors, HCA1 (GPR81), HCA2 (GPR109A), and HCA3 (GPR109B), which are G protein-coupled receptors for fatty acids.
In the laboratory it is a common precipitant and cryoprotectant in protein crystallography. Since hexylene glycol is compatible with polar and nonpolar molecules, it competes with the solvent in a crystallography experiment causing the protein to precipitate. Hexylene glycol is so effective in protein crystallography because its amphiphilic nature and small, flexible structure allows it to bind to many different locations on a protein secondary structure including alpha helices and beta sheets. When hexylene glycol binds to these different locations, water is removed and the protein crystals anneal, which prevents ice formation during cryocrystallography techniques. Incorporation of hexylene glycol into solution has been known to improve the resolution of X-ray diffraction making protein structures easily identifiable. Additionally hexylene glycol is not a strong denaturing agent and thus does not significantly alter the structure of a protein during the crystallography procedure. Hexylene glycol is also used as a lubricant for polishing specimens in metallography. Like related diols, it forms borate esters.
Clear Lake Audiotorium is a six-track promo EP by De La Soul given out to A-list DJs in 1994, the catalog number is TB 1093 (Side A, "THIS SIDE" is TB 1093 A and Side B "OTHER SIDE" is TB 1093 B). It was composed of four tracks from the group's album Buhloone Mindstate and two non-album tracks—"Sh.Fe.Mc's" featuring A Tribe Called Quest, and "Stix & Stonz" featuring The Fearless Four, Grandmaster Caz, and Prince Whipper Whip. With only 500 copies pressed (vinyl and CD), Clear Lake Audiotorium remains one of the most sought-after De La Soul releases to date. Originally pressed on clear/light green vinyl and packaged in a clear plastic sleeve, the record has since been bootlegged on black vinyl. On March 7, 2025, exactly 31 years after its original release, the EP was released officially on streaming releases, alongside a limited physical re-release.
In botany, apical dominance is the phenomenon whereby the main, central stem of the plant is dominant over (i.e., grows more strongly than) other side stems; on a branch the main stem of the branch is further dominant over its own side twigs. Plant physiology describes apical dominance as the control exerted by the terminal bud (and shoot apex) over the outgrowth of lateral buds.
Sources: en.wikipedia.org
Biochemical differences between different organisms and humans are useful for drug development. For instance, penicillin kills bacteria by inhibiting the bacterial enzyme DD-transpeptidase, destroying the development of the bacterial cell wall and inducing cell death. Thus, the study of binding sites is relevant to many fields of research, including cancer mechanisms, drug formulation, and physiological regulation. The formulation of an inhibitor to mute a protein's function is a common form of pharmaceutical therapy.
The main method of treatment for potential death from signaling-related diseases involves either increasing or decreasing the susceptibility of apoptosis in diseased cells, depending on whether the disease is caused by either the inhibition of or excess apoptosis. For instance, treatments aim to restore apoptosis to treat diseases with deficient cell death and to increase the apoptotic threshold to treat diseases involved with excessive cell death. To stimulate apoptosis, one can increase the number of death receptor ligands (such as TNF or TRAIL), antagonize the anti-apoptotic Bcl-2 pathway, or introduce Smac mimetics to inhibit the inhibitor (IAPs). The addition of agents such as Herceptin, Iressa, or Gleevec works to stop cells from cycling and causes apoptosis activation by blocking growth and survival signaling further upstream. Finally, adding p53-MDM2 complexes displaces p53 and activates the p53 pathway, leading to cell cycle arrest and apoptosis. Many different methods can be used either to stimulate or to inhibit apoptosis in various places along the death signaling pathway. Apoptosis is a multi-step, multi-pathway cell-death programme that is inherent in every cell of the body. In cancer, the apoptosis cell-division ratio is altered. Cancer treatment by chemotherapy and irradiation kills target cells primarily by inducing apoptosis.
Cryptic binding sites are the binding sites that are transiently formed in an apo form or that are induced by ligand binding. Considering the cryptic binding sites increases the size of the potentially "druggable" human proteome from ~40% to ~78% of disease-associated proteins. The binding sites have been investigated by: support vector machine applied to "CryptoSite" data set, Extension of "CryptoSite" data set, long timescale molecular dynamics simulation with Markov state model and with biophysical experiments, and cryptic-site index that is based on relative accessible surface area.
The apical membrane or luminal membrane of a polarized cell is the surface of the plasma membrane that faces inward to the lumen. This is particularly evident in epithelial and endothelial cells, but also describes other polarized cells, such as neurons. The basolateral membrane or basolateral cell membrane of a polarized cell is the surface of the plasma membrane that forms its basal and lateral surfaces. It faces outwards, towards the interstitium, and away from the lumen. Basolateral membrane is a compound phrase referring to the terms "basal (base) membrane" and "lateral (side) membrane", which, especially in epithelial cells, are identical in composition and activity. Proteins (such as ion channels and pumps) are free to move from the basal to the lateral surface of the cell or vice versa in accordance with the fluid mosaic model. Tight junctions join epithelial cells near their apical surface to prevent the migration of proteins from the basolateral membrane to the apical membrane. The basal and lateral surfaces thus remain roughly equivalent to one another, yet distinct from the apical surface.
RGD and other bioactive ligands can be presented on the surface of a biomaterial in a number of different spatial arrangements, and it has been demonstrated that these arrangements have a significant impact on cell behavior. In self-assembled monolayers, it was found that adhesion and proliferation of both human umbilical vein endothelial cells (HUVECs) and human mesenchymal stem cells (MSCs) increased as a function of RGD peptide density. These studies also showed that RGD density could change integrin expression, which has been postulated to enable control of biochemical signaling pathways. Further investigation of MSCs on self-assembled monolayers showed that modulating RGD density and the affinity of RGD for αvβ3 (through use of linear and cyclized RGD) could be used to control the differentiation of MSCs. The effect of RGD presentation on cells in 3D biomaterials, which more accurately replicate the in vivo environment, has also been evaluated. In degradable polyethylene glycol hydrogels, the length of capillary-like structures formed by HUVECs was directly proportional to the density of RGD in the hydrogel. Additionally, studies in nano-patterning have shown that, whereas an increase in global RGD density increases cell adhesion strength until saturation, an increase in local (mico/nano-scale) RGD density does not follow this trend.
Sources: en.wikipedia.org
Dry peptides are generally kept in sealed, desiccated containers at low temperature, often -20 °C or colder. Protection from light, moisture, and oxygen helps slow degradation. The exact condition depends on the peptide sequence and supplier guidance.
Aliquoting divides a solution into smaller portions so that each portion is handled once. This reduces repeated freeze-thaw cycles and limits contamination risk. It also makes it easier to track usage and maintain consistent test conditions.
Refreezing is possible for some peptides but can promote aggregation or precipitation. The effect depends on the peptide, solvent, concentration, and freezing rate. Many laboratory protocols therefore recommend single-use aliquots instead of repeated refreezing.
Peptide degradation can arise from hydrolysis, oxidation, deamidation, and aggregation. The dominant route depends on the peptide sequence and the storage environment. Temperature, moisture, oxygen, light, and pH all influence the rate.